Proteintech, 17830-1-AP, UCHL5IP Polyclonal antibody

Size: 20ul / 150ul The UCHL5IP (17830-1-AP) by Proteintech is a Polyclonal antibody targeting UCHL5IP in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 17830-1-AP targets UCHL5IP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IHC detected in: human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12225 Product name: Recombinant human UCHL5IP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 38-368 aa of BC008141 Sequence: AVEVFGKLKDLNCPFLEGLYITEPKTIQELLCSPSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFMDQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDWQWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLILAFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWGGSSSVMSLATKMNELMEK Predict reactive species Full Name: UCHL5 interacting protein Calculated Molecular Weight: 368 aa, 41 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC008141 Gene Symbol: UCHL5IP Gene ID (NCBI): 55559 RRID: AB_2878447 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99871 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.