Proteintech, 17847-1-AP, BDKRB2 Polyclonal antibody

Size: 20ul / 150ul The BDKRB2 (17847-1-AP) by Proteintech is a Polyclonal antibody targeting BDKRB2 in WB, ELISA applications with reactivity to human samples 17847-1-AP targets BDKRB2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The BK system is important in cancer occurrence and progression. It stimulates cell proliferation, migration, and angiogenesis, contributing to tumor progression. As a vital receptor of bradykinin, BDKRB2 (Bradykinin receptor B2) has been widely reported in a range of malignancies, including cervical cancer, triple-negative breast cancer, hepatocellular carcinoma (HCC), gastric cancer, colorectal cancer, prostate cancer, bladder cancer, head and neck squamous cell carcinomas, and chondrosarcoma (PMID: 33686021). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12268 Product name: Recombinant human BDKRB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 291-391 aa of BC074895 Sequence: FLDTLHRLGILSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ Predict reactive species Full Name: bradykinin receptor B2 Calculated Molecular Weight: 391 aa, 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC074895 Gene Symbol: BDKRB2 Gene ID (NCBI): 624 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30411 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.