Proteintech, 17852-1-AP, TNFSF8 Polyclonal antibody

Size: 20ul / 150ul The TNFSF8 (17852-1-AP) by Proteintech is a Polyclonal antibody targeting TNFSF8 in IHC, ELISA applications with reactivity to human, mouse, rat samples 17852-1-AP targets TNFSF8 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information TNFSF8, also named as CD30LG and CD153, is a member of the tumor necrosis factor (TNF) receptor superfamily, is a surface antigen used as a clinical marker for Hodgkin lymphoma and related hematologic malignancies. It induces proliferation of T-cells. CD30L enhanced the proliferation of CD3-activated T cells, but induced differential responses, including cell death, in several CD30-positive lymphoma-derived cell lines. For Glycosylation, the MW in WB detection is about 35-40 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12303 Product name: Recombinant human TNFSF8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 61-234 aa of BC093630 Sequence: VVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 8 Calculated Molecular Weight: 234 aa, 26 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC093630 Gene Symbol: TNFSF8 Gene ID (NCBI): 944 RRID: AB_2878452 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P32971 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.