Proteintech, 17895-1-AP, BHLHE40 Polyclonal antibody

Size: 20ul / 150ul The BHLHE40 (17895-1-AP) by Proteintech is a Polyclonal antibody targeting BHLHE40 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 17895-1-AP targets BHLHE40 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C2C12 cells, HeLa cells, MDA-MB-231 cells Positive IP detected in: HeLa cells Positive IHC detected in: human endometrial cancer tissue, human pancreas cancer tissue, mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BHLHE40 (Basic Helix-Loop-Helix Family Member E40), also known as BHLHB2, STRA13, DEC1, or SHARP2, is a member of the basic helix-loop-helix (bHLH) protein family, a large superfamily of transcriptional regulators expressed in many organisms. BHLHE40 is known to regulate a wide variety of essential cellular processes, including cell cycle, cellular proliferation, programmed cell death, cellular development and differentiation, as well as circadian rhythms (PMID: 34551158). It is reported that BHLHE40 is overexpressed in gastric, breast, and brain tumors; and downregulated in colorectal, esophageal, pancreatic and lung cancer (PMID: 32577154). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12236 Product name: Recombinant human BHLHE40 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-412 aa of BC082238 Sequence: MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD Predict reactive species Full Name: basic helix-loop-helix family, member e40 Calculated Molecular Weight: 412 aa, 46 kDa Observed Molecular Weight: 46-50 kDa GenBank Accession Number: BC082238 Gene Symbol: BHLHE40 Gene ID (NCBI): 8553 RRID: AB_2065351 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14503 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.