Proteintech, 18099-1-AP, TRAF3 Polyclonal antibody

Size: 20ul / 150ul The TRAF3 (18099-1-AP) by Proteintech is a Polyclonal antibody targeting TRAF3 in WB, IP, ELISA applications with reactivity to human, mouse samples 18099-1-AP targets TRAF3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, multi-cells, HEK-293 cells, HeLa cells, NIH/3T3 cells, Raji cells, Jurkat cells Positive IP detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information TNF receptor-associated factor 3 (TRAF3) has many alternative names including CAP-1, CD40 receptor-associated factor 1(CRAF1), CD40-binding protein(CD40BP) and LMP1-associated protein 1 (LAP1). TRAF3 regulates pathways leading to the activation of NF-kappa-B and MAP kinases, and plays a central role in the regulation of innate immune response. It modulates signaling pathways leading to the production of cytokines and interferon. As an essential constituent of several E3 ubiquitin-protein ligase complexes, TRAF3 promote 'Lys-63'-linked ubiquitination of target proteins. Moreover, TRAF3 undergoes both 'Lys-48'-linked and 'Lys-63'-linked ubiquitination in response to various stimuli and is deubiquitinated by OTUB1, OTUB2 and OTUD5. Several alternatively spliced transcript variants encoding distinct isoforms (64 kDa and 55 kDa) have been reported. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12185 Product name: Recombinant human TRAF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-351 aa of BC075087 Sequence: KMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMK Predict reactive species Full Name: TNF receptor-associated factor 3 Calculated Molecular Weight: 568 aa, 64 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC075087 Gene Symbol: TRAF3 Gene ID (NCBI): 7187 RRID: AB_10837364 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13114 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.