Proteintech, 18189-1-AP, Mast Cell Chymase Polyclonal antibody

Size: 20ul / 150ul The Mast Cell Chymase (18189-1-AP) by Proteintech is a Polyclonal antibody targeting Mast Cell Chymase in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 18189-1-AP targets Mast Cell Chymase in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, human heart tissue, human placenta tissue, MCF-7 cells Positive IP detected in: mouse heart tissue Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Mast Cell Chymase, also named as CYH, CYM and CMA1, belongs to the peptidase S1 family and Granzyme subfamily. It is the major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. CMA1 maybe a target for cardiovascular disease therapies. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12909 Product name: Recombinant human CMA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of BC069370 Sequence: MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN Predict reactive species Full Name: chymase 1, mast cell Calculated Molecular Weight: 247 aa, 27 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC069370 Gene Symbol: Mast Cell Chymase Gene ID (NCBI): 1215 RRID: AB_2083611 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P23946 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.