Proteintech, 18214-1-AP, CCL28 Polyclonal antibody

Size: 20ul / 150ul The CCL28 (18214-1-AP) by Proteintech is a Polyclonal antibody targeting CCL28 in WB, IHC, ELISA applications with reactivity to human, mouse samples 18214-1-AP targets CCL28 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human spleen tissue, Jurkat cells, mouse spleen tissue, PC-3 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CCL28, also named as SCYA28, CCK1 and MEC, belongs to the intercrine beta (chemokine CC) family. It has chemotactic activity for resting CD4, CD8 T-cells and eosinophils. CCL28 binds to CCR3 and CCR10 and induces calcium mobilization in a dose-dependent manner. CCL28 is expressed in a variety of human and mouse tissues, and it appears to be predominantly produced by epithelial cells. It is produced by epithelial cells of these tissues suggesting that this chemokine can play an important role by linking homing mechanisms between the gut, nasal mucosa and mammary gland (MG). In WB test, CCL28 is 14kd and 8-9kd(a putatively to a degradation fragment). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12920 Product name: Recombinant human CCL28 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-127 aa of BC069532 Sequence: MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY Predict reactive species Full Name: chemokine (C-C motif) ligand 28 Calculated Molecular Weight: 127 aa, 14 kDa Observed Molecular Weight: 8 kDa-9 kDa GenBank Accession Number: BC069532 Gene Symbol: CCL28 Gene ID (NCBI): 56477 RRID: AB_2262251 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRJ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.