Proteintech, 18274-1-AP, ATP6V0D1 Polyclonal antibody

Size: 20ul / 150ul The ATP6V0D1 (18274-1-AP) by Proteintech is a Polyclonal antibody targeting ATP6V0D1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 18274-1-AP targets ATP6V0D1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, human placenta tissue, HeLa cells, mouse kidney tissue, mouse testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: mouse kidney tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ATP6V0D1(V-type proton ATPase subunit d 1) is also named as ATP6D, VPATPD and belongs to the V-ATPase V0D/AC39 subunit family.It is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13002 Product name: Recombinant human ATP6V0D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC008861 Sequence: MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF Predict reactive species Full Name: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d1 Calculated Molecular Weight: 351 aa, 40 kDa Observed Molecular Weight: 37-41 kDa GenBank Accession Number: BC008861 Gene Symbol: ATP6V0D1 Gene ID (NCBI): 9114 RRID: AB_2258877 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61421 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.