Proteintech, 18285-1-AP, DDX19B Polyclonal antibody

Size: 20ul / 150ul The DDX19B (18285-1-AP) by Proteintech is a Polyclonal antibody targeting DDX19B in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 18285-1-AP targets DDX19B in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, HEK-293 cells, HeLa cells, NIH/3T3 cells Positive IP detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13165 Product name: Recombinant human DDX19B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-370 aa of BC010008 Sequence: MGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN Predict reactive species Full Name: DEAD (Asp-Glu-Ala-As) box polypeptide 19B Calculated Molecular Weight: 479aa,54 kDa; 370aa,42 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC010008 Gene Symbol: DDX19B Gene ID (NCBI): 11269 RRID: AB_10597088 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UMR2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.