Proteintech, 18343-1-AP, Cytokeratin 10 Polyclonal antibody

Size: 20ul / 150ul The Cytokeratin 10 (18343-1-AP) by Proteintech is a Polyclonal antibody targeting Cytokeratin 10 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 18343-1-AP targets Cytokeratin 10 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skin tissue, A431 cells, rat skin tissue Positive IHC detected in: human cervical cancer tissue, human breast cancer tissue, human lung cancer tissue, human skin cancer tissue, rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse skin tissue Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. As a type I keratin, keratin 10 is a suprabasal marker of differentiation in stratified squamous epithelia. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13136 Product name: Recombinant human KRT10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 235-584 aa of BC034697 Sequence: RLKYENEVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTGDVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY Predict reactive species Full Name: keratin 10 Calculated Molecular Weight: 584 aa, 59 kDa Observed Molecular Weight: 50-59 kDa GenBank Accession Number: BC034697 Gene Symbol: Cytokeratin 10 Gene ID (NCBI): 3858 RRID: AB_10863654 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P13645 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.