Product Description
Size: 20ul / 150ul
The SLC6A14 (18388-1-AP) by Proteintech is a Polyclonal antibody targeting SLC6A14 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples
18388-1-AP targets SLC6A14 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: mouse lung tissue
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)-P: IF-P : 1:50-1:500
Background Information
Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) (SLC6A14) is a member of the Na+- and Cl−-dependent neurotransmitter transporter family and transports both neutral and cationic amino acids in an Na+- and Cl−-dependent manner.
Specification
Tested Reactivity: human, mouse
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag12857 Product name: Recombinant human SLC6A14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 138-264 aa of BC093710 Sequence: YSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGVIVWYLALCLLLAWLIVGAALFKGIKSSGKV Predict reactive species
Full Name: solute carrier family 6 (amino acid transporter), member 14
Calculated Molecular Weight: 642 aa, 72 kDa
GenBank Accession Number: BC093710
Gene Symbol: SLC6A14
Gene ID (NCBI): 11254
RRID: AB_3085563
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UN76
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924