Proteintech, 18388-1-AP, SLC6A14 Polyclonal antibody

Size: 20ul / 150ul The SLC6A14 (18388-1-AP) by Proteintech is a Polyclonal antibody targeting SLC6A14 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 18388-1-AP targets SLC6A14 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse lung tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Sodium- and chloride-dependent neutral and basic amino acid transporter B(0+) (SLC6A14) is a member of the Na+- and Cl−-dependent neurotransmitter transporter family and transports both neutral and cationic amino acids in an Na+- and Cl−-dependent manner. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag12857 Product name: Recombinant human SLC6A14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 138-264 aa of BC093710 Sequence: YSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGVIVWYLALCLLLAWLIVGAALFKGIKSSGKV Predict reactive species Full Name: solute carrier family 6 (amino acid transporter), member 14 Calculated Molecular Weight: 642 aa, 72 kDa GenBank Accession Number: BC093710 Gene Symbol: SLC6A14 Gene ID (NCBI): 11254 RRID: AB_3085563 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UN76 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.