Proteintech, 18470-1-AP, CD133 Polyclonal antibody

Size: 20ul / 150ul The CD133 (18470-1-AP) by Proteintech is a Polyclonal antibody targeting CD133 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 18470-1-AP targets CD133 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HT-29 cells, mouse kidney tissue, mouse pancreas tissue, rat kidney tissue, Caco-2 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CD133, also known as PROM1 (prominin-1) or AC133, belongs to the prominin family. CD133 is a transmembrane glycoprotein with an NH2-terminal extracellular domain, five transmembrane loops and a cytoplasmic tail. The expression of CD133 has been reported in hematopoietic stem cells, endothelial progenitor cells, neuronal and glial stem cells, suggesting the potential role of CD133 as a cell surface marker of adult stem cells. CD133 has also been reported as a marker of cancer stem cells in various human tumors. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13328 Product name: Recombinant human CD133 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 806-856 aa of BC012089 Sequence: LAKYYRRMDSEDVYDDVETIPMKNMENGNNGYHKDHVYGIHNPVMTSPSQH Predict reactive species Full Name: prominin 1 Calculated Molecular Weight: 97 kDa Observed Molecular Weight: 115 kDa-120 kDa GenBank Accession Number: BC012089 Gene Symbol: CD133 Gene ID (NCBI): 8842 RRID: AB_2172859 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43490 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.