Proteintech, 19107-1-AP, ALPK1 Polyclonal antibody

Size: 20ul / 150ul The ALPK1 (19107-1-AP) by Proteintech is a Polyclonal antibody targeting ALPK1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 19107-1-AP targets ALPK1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, HEK-293 cells, HepG2 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Alpha-protein kinase 1, also known as alpha-kinase 1 (ALPK1), is associated with chronic kidney disease (CKD), myocardial infarction, gout and type 2 diabetes mellitus (DM). ALPK1 mutant has been reported to cause severe defects in motor co‐ordination in mice. ALPK1 enhances the expression of proinflammatory cytokines including IL-1β, IL-8 and TGF-β1 in cultured human THP1 and human embryonic kidney 293 (HEK293) cells (PMID: 31557402, PMID: 26275947). ALPK1 short isoform (108 kDa) was highly expressed in brain, spinal cord, heart, lung, spleen, thymus, small intestine, skin and testis, while detectable inskeletal muscle and kidney. ALPK1 large isoform (130 kDa) appeared in heart, lung, thymus and skin (PMID: 21208416). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5320 Product name: Recombinant human ALPK1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-347 aa of BC060780 Sequence: MNNQKVVAVLLQECKQVLDQLLLEAPDVSEEDKSEDQRCRALLPSELRTLIQEAKEMKWPFVPEKWQYKQAVGPEDKTNLKDVIGAGLQQLLASLRASILARDCAAAAAIVFLVDRFLYGLDVSGKLLQVAKGLHKLQPATPIAPQVVIRQARISVNSGKLLKAEYILSSLISNNGATGTWLYRNESDKVLVQSVCIQIRGQILQKLGMWYEAAELIWASIVGYLALPQPDKKGLSTSLGILADIFVSMSKNDYEKFKNNPQINLSLLKEFDHHLLSAAEACKLAAAFSAYTPLFVLTAVNIRGTCLLSYSSSNDCPPELKNLHLCEAKEAFEIGLLTKRDDEPVTG Predict reactive species Full Name: alpha-kinase 1 Calculated Molecular Weight: 139 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC060780 Gene Symbol: ALPK1 Gene ID (NCBI): 80216 RRID: AB_10638642 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96QP1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.