Proteintech, 19112-1-AP, GOLPH3 Polyclonal antibody

Size: 20ul / 150ul The GOLPH3 (19112-1-AP) by Proteintech is a Polyclonal antibody targeting GOLPH3 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 19112-1-AP targets GOLPH3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse lung tissue, rat testis tissue, mouse testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human colon cancer tissue, human placenta tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information GOLPH3 (also called GPP34, GMx33, MIDAS, or yeast Vps74p) is a 34-kDa Golgi-associated protein conserved from yeast to human. GOLPH3 binds to PtdIns(4)P-rich trans-Golgi membranes and MYO18A conveying a tensile force required for efficient tubule and vesicle formation (PMID: 19837035). GOLPH3 has been recently demonstrated as a novel oncoprotein amplified in various types of human malignancies, including melanoma, breast, non-small cell lung cancer, gliomas and connective tissue tumors (PMID:19553991; 23006319; 21499727; 22745132). Enhanced activation of mTOR signalling represents a molecular basis for the oncogenic activity of GOLPH3 (PMID: 19553991). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5443 Product name: Recombinant human GOLPH3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-298 aa of BC033725 Sequence: MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDDDKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALRGRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQNWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMTTHPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLENAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK Predict reactive species Full Name: golgi phosphoprotein 3 (coat-protein) Calculated Molecular Weight: 298 aa, 34 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC033725 Gene Symbol: GOLPH3 Gene ID (NCBI): 64083 RRID: AB_2113342 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H4A6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.