Proteintech, 19279-1-AP, OAS2 Polyclonal antibody

Size: 20ul / 150ul The OAS2 (19279-1-AP) by Proteintech is a Polyclonal antibody targeting OAS2 in WB, IHC, IP, ELISA applications with reactivity to human samples 19279-1-AP targets OAS2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IFN alpha treated A549 cells, Daudi cells, Jurkat cells Positive IP detected in: Jurkat cells Positive IHC detected in: human colon cancer, human breast cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information The 2-prime,5-prime oligoadenylate synthetases (OASs), such as OAS2, are IFN-induced proteins characterized by their capacity to catalyze the synthesis of 2-prime,5-prime oligomers of adenosine (2-5As). OAS2 is also named as p69 OAS / p71 OAS. It has 3 isoforms(71/69/20 kDa) produced by alternative splicing. The OAS2 isozymes are 69-71 kDa and form dimers(PMID:17765707). Glycosylation is essential for its activity(PMID:9880569). Constitutive expression of the 69-kDa form of the OAS2 protein in human cells inhibited the replication of encephalomyocarditis virus (EMCV) but not that of VSV, Sendai virus, or reovirus(PMID:16501108). This antibody is specific to isoform p71 and isoform p69 of OAS2. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6170 Product name: Recombinant human OAS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 335-687 aa of BC049215 Sequence: VLPAPLFTTPGHLLDKFIKEFLQPNKCFLEQIDSAVNIIRTFLKENCFRQSTAKIQIVRGGSTAKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKEEELEVSFEPPKWKAPRVLSFSLKSKVLNESVSFDVLPAFNALGQLSSGSTPSPEVYAGLIDLYKSSDLPGGEFSTCFTVLQRNFIRSRPTKLKDLIRLVKHWYKECERKLKPKGSLPPKYALELLTIYAWEQGSGVPDFDTAEGFRTVLELVTQYQQLCIFWKVNYNFEDETVRKFLLSQLQKTRPVILDPAEPTGDVGGGDRWCWHLLAKEAKEWLSSPCFKDGTGNPIPPWKVPVKVI Predict reactive species Full Name: 2'-5'-oligoadenylate synthetase 2, 69/71kDa Calculated Molecular Weight: 82 kDa Observed Molecular Weight: 66-71 kDa GenBank Accession Number: BC049215 Gene Symbol: OAS2 Gene ID (NCBI): 4939 RRID: AB_10642832 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29728 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.