Proteintech, 19291-1-AP, EGFL7 Polyclonal antibody

Size: 20ul / 150ul The EGFL7 (19291-1-AP) by Proteintech is a Polyclonal antibody targeting EGFL7 in WB, ELISA applications with reactivity to human, rat samples 19291-1-AP targets EGFL7 in WB, IHC, IF, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat eye tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information Epidermal growth factor-like domain-containing protein 7 (EGFL7), also known as vascular endothelial statin, is an endothelial cell-derived secreted factor that regulates vascular tube formation. This protein may be involved in the growth and proliferation of tumor cells. Recent studies have reported elevated expression of EGFL7 in several tumors and cancer cell lines, including kidney tumors, malignant gliomas, hepatocellular carcinomas, and colon cancers. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6559 Product name: Recombinant human EGFL7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 20-273 aa of BC012377 Sequence: TEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCINTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS Predict reactive species Full Name: EGF-like-domain, multiple 7 Calculated Molecular Weight: 273 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC012377 Gene Symbol: EGFL7 Gene ID (NCBI): 51162 RRID: AB_10643993 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHF1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.