Proteintech, 19569-1-AP, KIAA0494 Polyclonal antibody

Size: 20ul / 150ul The KIAA0494 (19569-1-AP) by Proteintech is a Polyclonal antibody targeting KIAA0494 in WB, ELISA applications with reactivity to human samples 19569-1-AP targets KIAA0494 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, SMMC-7721 cells, HeLa cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information The function of KIAA0494 remains largely unknown. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13757 Product name: Recombinant human KIAA0494 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 145-495 aa of BC002525 Sequence: MGLNKVWINITEMNKQISLLTSAVNHLKANVKSAADLISLPTTVEGLQKSVASIGNTLNSVHLAVEALQKTVDEHKKTMELLQSDMNQHFLKETPGSNQIIPSPSATSELDNKTHSENLKQDILYLHNSLEEVNSALVGYQRQNDLKLEGMNETVSNLTQRVNLIESDVVAMSKVEKKANLSFSMMGDRSATLKRQSLDQVTNRTDTVKIQSIKKEDSSNSQVSKLREKLQLISALTNKPESNRPPETADEEQVESFTSKPSALPKFSQFLGDPVEKAAQLRPISLPGVSSTEDLQDLFRKTGQDVDGKLTYQEIWTSLGSAMPEPESLRAFDSDGDGRYSFLELRVALGI Predict reactive species Full Name: KIAA0494 Calculated Molecular Weight: 495 aa, 55 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC002525 Gene Symbol: KIAA0494 Gene ID (NCBI): 9813 RRID: AB_2878591 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75071 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.