Proteintech, 19570-1-AP, FAM32A Polyclonal antibody

Size: 20ul / 150ul The FAM32A (19570-1-AP) by Proteintech is a Polyclonal antibody targeting FAM32A in WB, IF/ICC, ELISA applications with reactivity to human samples 19570-1-AP targets FAM32A in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A2780 cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information FAM32A (family with sequence similarity 32 member) is also known as ovarian tumor associated gene-12 (OTAG-12, OTAG12) and its expression is suppressed in ovarian cancer. FAM32A is involved in increased cell proliferation and suppresses apoptosis (PMID: 21339736). FAM32A protein is a 13 kDa protein that consists of 112 amino acids and is predominantly located in the nucleus (PMID: 39730183). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13761 Product name: Recombinant human FAM32A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-112 aa of BC000639 Sequence: MEAYEQVQKGPLKLKGVAELGVTKRKKKKKDKDKAKLLEAMGTSKKNEEEKRRGLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK Predict reactive species Full Name: family with sequence similarity 32, member A Calculated Molecular Weight: 112 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC000639 Gene Symbol: FAM32A Gene ID (NCBI): 26017 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y421 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.