Proteintech, 19625-1-AP, HYAL3 Polyclonal antibody

Size: 20ul / 150ul The HYAL3 (19625-1-AP) by Proteintech is a Polyclonal antibody targeting HYAL3 in WB, IHC, ELISA applications with reactivity to human samples 19625-1-AP targets HYAL3 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human brain tissue, HepG2 cells Positive IHC detected in: human testis tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8611 Product name: Recombinant human HYAL3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC005896 Sequence: MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNSLGIIANRGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSALFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDDLVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVT Predict reactive species Full Name: hyaluronoglucosaminidase 3 Calculated Molecular Weight: 417aa,47 kDa; 463aa,52 kDa Observed Molecular Weight: 47 kDa, 55 kDa GenBank Accession Number: BC005896 Gene Symbol: HYAL3 Gene ID (NCBI): 8372 RRID: AB_10666437 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43820 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.