Proteintech, 19826-1-AP, TM7SF3 Polyclonal antibody

Size: 20ul / 150ul The TM7SF3 (19826-1-AP) by Proteintech is a Polyclonal antibody targeting TM7SF3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 19826-1-AP targets TM7SF3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, HepG2 cells, mouse pancreas tissue, mouse testis tissue, U2OS cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The seven-transmembrane superfamily member 3 protein (TM7SF3) is a pro-survival factor induced by p53 that regulates protein homeostasis and attenuates cellular stress. TM7SF3 inhibits caspase 3/7 while siRNA-mediated silencing of TM7SF3 accelerates ER stress and the unfolded protein responses (UPR). This involves inhibitory phosphorylation of eIF2α activity and increased expression of ATF3, ATF4, and C/EBP, followed by induction of apoptosis. TM7SF3 maintains cellular reducing power within physiological levels and reduces the content of proapoptotic proteins such as FAS, FADD, and caspase-8. (PMID: 36304109) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13919 Product name: Recombinant human TM7SF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC005176 Sequence: MGFLQLLVVAVLASEHRVAGAAEVFGNSSEGLIEFSVGKFRYFELNRPFPEEAILHDISSNVTFLIFQIHSQYQNTTVSFSPTLLSNSSETGTASGLVFILRPEQSTCTWYLGTSGIQPVQNMAILLSYSERDPVPGGCNLEFDLDIDPNIYLEYNFFETTIKFAPANLGYARGVDPPPCDAGTDQDSRWRLQYDVYQYFLPENDLTEEMLLKHLQRMVSVPQVKASALKVVTLTANDKTSVSFSSLPGQGVIYNVIVWDPFLNTSAAYIPAHTYACSFEAGEGSCASLGRVSSK Predict reactive species Full Name: transmembrane 7 superfamily member 3 Calculated Molecular Weight: 570 aa, 64 kDa Observed Molecular Weight: 64-80 kDa GenBank Accession Number: BC005176 Gene Symbol: TM7SF3 Gene ID (NCBI): 51768 RRID: AB_10638000 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NS93 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.