Proteintech, 19849-1-AP, FAM50A Polyclonal antibody

Size: 20ul / 150ul The FAM50A (19849-1-AP) by Proteintech is a Polyclonal antibody targeting FAM50A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 19849-1-AP targets FAM50A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, Jurkat cells, NIH/3T3 cells Positive IHC detected in: rat colon tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FAM50A belongs to the FAM50 family. It is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13907 Product name: Recombinant human FAM50A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 76-154 aa of BC000028 Sequence: KQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKR Predict reactive species Full Name: family with sequence similarity 50, member A Calculated Molecular Weight: 325 aa, 39 kDa Observed Molecular Weight: 40 kDa GenBank Accession Number: BC000028 Gene Symbol: FAM50A Gene ID (NCBI): 9130 RRID: AB_10641032 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14320 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.