Proteintech, 19851-1-AP, TMEM173/STING Polyclonal antibody

Size: 20ul / 150ul The TMEM173/STING (19851-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM173/STING in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 19851-1-AP targets TMEM173/STING in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, CoIP, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, HEK-293 cells, HepG2 cells, mouse kidney tissue, mouse spleen tissue, Raji cells, THP-1 cells, HT-29 cells, mouse thymus tissue, C2C12 cells, RAW 264.7 cells, mouse testis tissue Positive IP detected in: mouse spleen tissue Positive IHC detected in: human tonsillitis tissue, rat thymus tissue, mouse thymus tissue, human spleen tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Positive IF-Fro detected in: mouse brain tissue Positive IF/ICC detected in: HT-29 cells, human tonsillitis tissue, THP-1 cells Positive FC (Intra) detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Stimulator of interferon genes (STING, also known as ERIS, MITA and MPYS, and encoded by TMEM173) is a transmembrane adaptor protein that facilitates innate immune signaling (PMID: 18724357). STING is widely expressed in various cell types such as endothelial cells, epithelial cells, T cells, macrophages, and dendritic cells (PMID: 26603901). It is predominantly located in the endoplasmic reticulum (ER). STING functions as a sensor of cytosolic DNA and promotes the production of type I interferons and pro-inflammatory cytokines. STING is a 379 amino acid protein with a calculated molecular weight of 42 kDa. It has been observed at 35-40 kDa (PMID: 27324217; 29632140; 30918080), and 70-80 kDa corresponding to the expected size of a STING dimer (PMID: 25790474; 29491158). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, monkey, bovine, hamster Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13921 Product name: Recombinant human TMEM173 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-379 aa of BC047779 Sequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS Predict reactive species Full Name: transmembrane protein 173 Calculated Molecular Weight: 379 aa, 42 kDa Observed Molecular Weight: 35-40 kDa, 80 kDa GenBank Accession Number: BC047779 Gene Symbol: STING Gene ID (NCBI): 340061 RRID: AB_10665370 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86WV6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.