Iright
BRAND / VENDOR: Proteintech

Proteintech, 19857-1-AP, SMUG1 Polyclonal antibody

CATALOG NUMBER: 19857-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMUG1 (19857-1-AP) by Proteintech is a Polyclonal antibody targeting SMUG1 in WB, ELISA applications with reactivity to human samples 19857-1-AP targets SMUG1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells, HEK-293 cells, HeLa cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information UNG(Uracil-DNA glycosylase) removes uracil in DNA resulting from deamination of cytosine or replicative incorporation of dUMP instead of dTMP. Thus, UNG plays a role in suppressing GC-to-AT transition mutations.The UNG gene encodes 2 isoforms that are individually targeted to the mitochondria and the nucleus(PMID:12369930).Defects in UNG are a cause of immunodeficiency with hyper-IgM type 5 (HIGM5). This antibody is specific to UNG. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13934 Product name: Recombinant human SMUG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC000417 Sequence: MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQS Predict reactive species Full Name: single-strand-selective monofunctional uracil-DNA glycosylase 1 Calculated Molecular Weight: 177 aa, 20 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC000417 Gene Symbol: SMUG1 Gene ID (NCBI): 23583 RRID: AB_3085589 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q53HV7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924