Iright
BRAND / VENDOR: Proteintech

Proteintech, 19908-1-AP, RGP1 Polyclonal antibody

CATALOG NUMBER: 19908-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RGP1 (19908-1-AP) by Proteintech is a Polyclonal antibody targeting RGP1 in WB, ELISA applications with reactivity to human samples 19908-1-AP targets RGP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MG-63 cells, THP-1 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13902 Product name: Recombinant human RGP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-391 aa of BC001725 Sequence: MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPPKILFCDLRLDPGESKSYSYSEVLPIEGPPSFRGQSVKYVYKLTIGCQRVNSPITLLRVPLRVLVLTGLQDVRFPQDEAVAPSSPFLEEDEGGKKDSWLAELAGERLMAATSCRSLHLYNISDGRGKVGTFGIFKSVYRLGEDVVGTLNLGEGTVACLQFSVSLQTEERVQPEYQRRRGAGGVPSVSHVTHARHQESCLHTTRTSFSLPIPLSSTPGFCTAIVSLKWRLHFEFVTSREPGLVLLPPVEQPEPTTWTGPEQVPVDTFSWDLPIKVLPTSPTLASYAAPGPSTSTITI Predict reactive species Full Name: RGP1 retrograde golgi transport homolog (S. cerevisiae) Calculated Molecular Weight: 391 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC001725 Gene Symbol: RGP1 Gene ID (NCBI): 9827 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92546 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924