Iright
BRAND / VENDOR: Proteintech

Proteintech, 20171-1-AP, GLS2 Polyclonal antibody

CATALOG NUMBER: 20171-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLS2 (20171-1-AP) by Proteintech is a Polyclonal antibody targeting GLS2 in WB, IHC, ELISA applications with reactivity to human samples 20171-1-AP targets GLS2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GLS2, also named as GA and GLS, belongs to the glutaminase family. It is Glutaminase liver isoform . GLS2 plays an important role in the regulation of glutamine catabolism. It promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. GLS2 may play a role in preventing tumor proliferation. This antibody is specific to GLS2. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14003 Product name: Recombinant human GLS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC059370 Sequence: MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDQ Predict reactive species Full Name: glutaminase 2 (liver, mitochondrial) Calculated Molecular Weight: 602 aa, 66 kDa Observed Molecular Weight: 66-70 kDa GenBank Accession Number: BC059370 Gene Symbol: GLS2 Gene ID (NCBI): 27165 RRID: AB_3085600 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UI32 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924