Product Description
Size: 20ul / 150ul
The GLS2 (20171-1-AP) by Proteintech is a Polyclonal antibody targeting GLS2 in WB, IHC, ELISA applications with reactivity to human samples
20171-1-AP targets GLS2 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells
Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
GLS2, also named as GA and GLS, belongs to the glutaminase family. It is Glutaminase liver isoform . GLS2 plays an important role in the regulation of glutamine catabolism. It promotes mitochondrial respiration and increases ATP generation in cells by catalyzing the synthesis of glutamate and alpha-ketoglutarate. GLS2 may play a role in preventing tumor proliferation. This antibody is specific to GLS2.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag14003 Product name: Recombinant human GLS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-61 aa of BC059370 Sequence: MRSMKALQKALSRAGSHCGRGGWGHPSRSPLLGGGVRHHLSEAAAQGRETPHSHQPQHQDQ Predict reactive species
Full Name: glutaminase 2 (liver, mitochondrial)
Calculated Molecular Weight: 602 aa, 66 kDa
Observed Molecular Weight: 66-70 kDa
GenBank Accession Number: BC059370
Gene Symbol: GLS2
Gene ID (NCBI): 27165
RRID: AB_3085600
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UI32
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924