Proteintech, 20331-1-AP, LTBR Polyclonal antibody

Size: 20ul / 150ul The LTBR (20331-1-AP) by Proteintech is a Polyclonal antibody targeting LTBR in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples 20331-1-AP targets LTBR in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue Positive IHC detected in: human hepatocirrhosis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Lymphotoxin-beta receptor (LTBR) is a receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. It can activate the NF-kappa-B signaling pathway upon stimulation with lymphotoxin (LTA1-LTB2) (PMID: 24248355). LTBR is constitutively expressed on stromal cells and myeloid lineage cells but not on T or B lymphocytes, which may be a novel immune checkpoint of tumor-associated macrophages (PMID: 20603617; 39429877). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14065 Product name: Recombinant human LTBR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-435 aa of BC026262 Sequence: KSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD Predict reactive species Full Name: lymphotoxin beta receptor (TNFR superfamily, member 3) Calculated Molecular Weight: 435 aa, 47 kDa Observed Molecular Weight: 47-60 kDa GenBank Accession Number: BC026262 Gene Symbol: LTBR Gene ID (NCBI): 4055 RRID: AB_10694276 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P36941 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.