Proteintech, 20414-1-AP, C11orf67 Polyclonal antibody

Size: 20ul / 150ul The C11orf67 (20414-1-AP) by Proteintech is a Polyclonal antibody targeting C11orf67 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20414-1-AP targets C11orf67 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, HepG2 cells, rat testis tissue Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information C11orf67 is predicted to be involved in positive regulation of fat cell differentiation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14258 Product name: Recombinant human C11orf67 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-122 aa of BC002752 Sequence: MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC Predict reactive species Full Name: chromosome 11 open reading frame 67 Calculated Molecular Weight: 122 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC002752 Gene Symbol: C11orf67 Gene ID (NCBI): 28971 RRID: AB_10694438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H7C9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.