Proteintech, 20421-1-AP, PIGM Polyclonal antibody

Size: 20ul / 150ul The PIGM (20421-1-AP) by Proteintech is a Polyclonal antibody targeting PIGM in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20421-1-AP targets PIGM in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14245 Product name: Recombinant human PIGM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 231-299 aa of BC019865 Sequence: VAVAGLTFFALSFGFYYEYGWEFLEHTYFYHLTRRDIRHNFSPYFYMLYLTAESKWSFSLGIAAFLPQL Predict reactive species Full Name: phosphatidylinositol glycan anchor biosynthesis, class M Calculated Molecular Weight: 423 aa, 49 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC019865 Gene Symbol: PIGM Gene ID (NCBI): 93183 RRID: AB_10734320 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3S5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.