Proteintech, 20505-1-AP, SNRNP27 Polyclonal antibody

Size: 20ul / 150ul The SNRNP27 (20505-1-AP) by Proteintech is a Polyclonal antibody targeting SNRNP27 in WB, ELISA applications with reactivity to human, mouse, rat samples 20505-1-AP targets SNRNP27 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, mouse heart tissue, rat heart tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SNRNP27 also named U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein. It is located in the cell nucleus. SNRNP27 may play a role in mRNA splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14308 Product name: Recombinant human SNRNP27 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 71-155 aa of BC017890 Sequence: RDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNRPLDFIA Predict reactive species Full Name: small nuclear ribonucleoprotein 27kDa (U4/U6.U5) Calculated Molecular Weight: 155 aa, 19 kDa Observed Molecular Weight: 23-27 kDa GenBank Accession Number: BC017890 Gene Symbol: SNRNP27 Gene ID (NCBI): 11017 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVK2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.