Proteintech, 20540-1-AP, AXIN2 Polyclonal antibody

Size: 20ul / 150ul The AXIN2 (20540-1-AP) by Proteintech is a Polyclonal antibody targeting AXIN2 in WB, ELISA applications with reactivity to human, mouse, rat samples 20540-1-AP targets AXIN2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, BxPC-3 cells, HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information Axis inhibition protein2 (AXIN2), also known as Coductin or Axil, is a multidomain scaffold protein that negatively regulate Wnt signaling. AXIN2 can directly interact with beta-catenin and GSK3B. AXIN2 has a number of phosphorylation sites, and also can undergo poly(ADP-ribosy)lation by tankyrase TNKS and TNKS2. Poly(ADP-ribosy)lated AXIN2 then get unbiquitinated by RNF146 and leads to its degradation and subsequent activation of Wnt signaling. AXIN2 is localized in the cytoplasm and its mutation is involved in colorectal cancer. Catalgo#20540-1-AP is a rabbit polyclonal antibdy raised against a 34 amino acid N-terminal of human AXIN2. Observed MW of AXIN2 is from 93-100 kDa (PMID: 11809809; 24607787). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14574 Product name: Recombinant human AXIN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 30-83 aa of BC006295 Sequence: EGETPPCQPGVGKGQVTKPMPVSSNTRRNEDGLGEPEGRASPDSPLTRWTKSLH Predict reactive species Full Name: axin 2 Calculated Molecular Weight: 843 aa, 94 kDa Observed Molecular Weight: 94-100 kDa GenBank Accession Number: BC006295 Gene Symbol: AXIN2 Gene ID (NCBI): 8313 RRID: AB_10694569 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2T1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.