Proteintech, 20641-1-AP, PTPIP51 Polyclonal antibody

Size: 20ul / 150ul The PTPIP51 (20641-1-AP) by Proteintech is a Polyclonal antibody targeting PTPIP51 in WB, IHC, IP, ELISA applications with reactivity to human samples 20641-1-AP targets PTPIP51 in WB, IHC, IF, IP, COIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Jurkat cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human paracancerous of skin cancer, human cervical cancer tissue, human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:1200 Background Information Protein tyrosine phosphatase-interacting protein 51 (PTPIP51),also known as RMDN3, is a mitochondrial membrane-anchored protein that interacts with ER membrane-bound VAPB. The VAPB-PTPIP51 interaction impacts on intracellular Ca2+ handling (PMID: 22131369, 28345618). PTPIP51 participates in multiple cellular processes, and dysfunction of PTPIP51 is implicated in diseases such as cancer and neurodegenerative disorders (PMID: 28345618). The known initiation sites in the Ptpip51 gene would lead to molecular protein masses of 52, 38 and 30 kDa (PMID: 18854601,19844996). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14708 Product name: Recombinant human PTPIP51 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC008970 Sequence: ESDNERDSDKESEDGEDEVSCETVKMGRKDSLDLEEEAASGASSALEAGGSSGLEDVLPLLQQADELHRGDEQGKREGFQLLLNNKLVYGSRQDFLWRLARAYSDMCELTEEVSEKKSYALDGKEEAEAALEKGDESADCH Predict reactive species Full Name: family with sequence similarity 82, member A2 Calculated Molecular Weight: 470 aa, 52 kDa Observed Molecular Weight: 52-60 kDa GenBank Accession Number: BC008970 Gene Symbol: PTPIP51 Gene ID (NCBI): 55177 RRID: AB_10695187 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96TC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.