Proteintech, 20761-1-AP, NUDT22 Polyclonal antibody

Size: 20ul / 150ul The NUDT22 (20761-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT22 in WB, ELISA applications with reactivity to human samples 20761-1-AP targets NUDT22 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information Human NUDT22 is a Mg2+-dependent UDP-glucose and UDP-galactose hydrolase, producing UMP and glucose 1-phosphate or galactose 1-phosphate. NUDT22 expression is consistently elevated in cancer tissues and high NUDT22 expression correlates with worse survival outcomes in patients. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14711 Product name: Recombinant human NUDT22 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC006129 Sequence: MDPEVTLLLQCPGGGLPQEQIQAELSPAHDRRPLPGGDEAITAIWETRLKAQPWLFDAPKFRLHSATLAPIGSRGPQLLLRLGLTSYRDFLGTNWSSSAAWLRQQGATDWGDTQAYLADPLGVGAALATADDFLVFLRRSRQVAEAPGLVDVPGGHPEPQALCPGGSPQHQDLAGQLVVHELFSSVLQEICDEVNLPLLTLSQPLLLGIARNETSAGRASAEFYVQCSLTSEQVRKHYLSGGPEAHESTGIFFVETQNVRRLPETEMWAELCPSAKGAIILYNRVQGSPTGAALGSPALLPPL Predict reactive species Full Name: nudix (nucleoside diphosphate linked moiety X)-type motif 22 Calculated Molecular Weight: 303 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC006129 Gene Symbol: NUDT22 Gene ID (NCBI): 84304 RRID: AB_3085621 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRQ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.