Iright
BRAND / VENDOR: Proteintech

Proteintech, 20785-1-AP, GLAST/EAAT1 Polyclonal antibody

CATALOG NUMBER: 20785-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GLAST/EAAT1 (20785-1-AP) by Proteintech is a Polyclonal antibody targeting GLAST/EAAT1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 20785-1-AP targets GLAST/EAAT1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Neuro-2a cells, C6 cells, mouse brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Neuro-2a cells Positive FC (Intra) detected in: Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information SLC1A3, also known as EAAT-1 or GLAST, is a membrane-bound protein localized in glial cells and pre-synaptic glutamatergic nerve endings. It transports the excitatory neurotransmitters L-glutamate and D-aspartate, which is essential for terminating the postsynaptic acction of glutamate. Recently, a correlation between expression/function of glial EAAT-1 and tumor proliferation has been reported. The exceptionally rare expression of EAAT-1 in non-neoplastic choroid plexus (CP) compared to choroid plexus tumors (CPT) may distinguishes neoplastic from normal CP. There are a number of splicing variants of SLC1A3, like GLAST1a and GLAST1b, exist due to the exon skipping. It also undergo glycosylation. Variety of bands can be observed in the western blotting assay: 50-55 kDa represents the unglycosylated GLAST1a or GLAST1b, 65-70 kDa correspond to the glycosylated proteins, larger proteins between 90-130 kDa may be the multimers of SLC1A3. (11086157, 17471058, 12546822) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, cow Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14177 Product name: Recombinant human SLC1A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 471-542 aa of BC037310 Sequence: VDWFLDRLRTTTNVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM Predict reactive species Full Name: solute carrier family 1 (glial high affinity glutamate transporter), member 3 Calculated Molecular Weight: 542 aa, 60 kDa Observed Molecular Weight: 50-55 kDa, 90-100 kDa GenBank Accession Number: BC037310 Gene Symbol: GLAST Gene ID (NCBI): 6507 RRID: AB_2878738 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43003 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924