Proteintech, 20873-1-AP, VMAT2 Polyclonal antibody

Size: 20ul / 150ul The VMAT2 (20873-1-AP) by Proteintech is a Polyclonal antibody targeting VMAT2 in WB, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples 20873-1-AP targets VMAT2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SGC-7901 cells, Jurkat cells Positive IF-P detected in: mouse brain tissue Positive IF-Fro detected in: rat cerebellum tissue, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information VMAT2 is a vesicular monoamine transporter that is responsible for the uptake and storage of monoamines (dopaine, norepinephrine, epinephrine, histamine and serotonin) in neurons, endocrine cells, and tumors deriving from these cells. Histamine-producing endocrine tumors (gastric carcinoids) expressed VMAT2 almost exclusively, thus VMAT2 is useful in classification of neuroendocrine tumors. Reduced expression of VMAT2 has often been observed in Parkinson's diseased (PD) brain, and detection of VMAT2 can be used to reflect the 4-(2-aminoethyl)benzene-1,2-diol neuron loss and predict the disease process. Several forms of VMAT2 can be observed upon the glycosylation: 45 kDa band corresponds to the native (deglycosylated) form, and the 55 and 75 kDa bands to glycosylated forms (PMID: 17582657). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14971 Product name: Recombinant human VMAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-127 aa of BC108928 Sequence: VVPIIPSYLYSIKHEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNE Predict reactive species Full Name: solute carrier family 18 (vesicular monoamine), member 2 Calculated Molecular Weight: 514 aa, 56 kDa Observed Molecular Weight: 45-55 kDa GenBank Accession Number: BC108928 Gene Symbol: VMAT2 Gene ID (NCBI): 6571 RRID: AB_10858619 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q05940 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.