Proteintech, 20876-1-AP, MIEN1 Polyclonal antibody

Size: 20ul / 150ul The MIEN1 (20876-1-AP) by Proteintech is a Polyclonal antibody targeting MIEN1 in WB, ELISA applications with reactivity to human samples 20876-1-AP targets MIEN1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, DU 145 cells, SK-BR-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information C17orf37 (chromosome 17 open reading frame 37), also known as C35/Rdx12/MGC14832, is located on human chromosome 17q12, 505 nucleotides from the 3¶ end of the ERBB2 oncogenes. C17orf37 expression positively correlates with grade and stage of breast cancer, and increased expression has been shown in prostate cancer cells and tissue specimens (PMID: 17121940, 19503095)..C17orf37 gene encodes a 12-kDa protein that does not have sequence similarity with any known protein. C17orf37 is expressed as a cytosolic protein with predominant membrane localization (PMID: 21628459). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14975 Product name: Recombinant human C17orf37 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC006006 Sequence: MSGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL Predict reactive species Full Name: chromosome 17 open reading frame 37 Calculated Molecular Weight: 115 aa, 12 kDa Observed Molecular Weight: 12 kDa GenBank Accession Number: BC006006 Gene Symbol: C17orf37 Gene ID (NCBI): 84299 RRID: AB_3085626 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRT3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.