Proteintech, 21036-1-AP, C9orf98 Polyclonal antibody

Size: 20ul / 150ul The C9orf98 (21036-1-AP) by Proteintech is a Polyclonal antibody targeting C9orf98 in IHC, ELISA applications with reactivity to human samples 21036-1-AP targets C9orf98 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15358 Product name: Recombinant human C9orf98 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-479 aa of BC034776 Sequence: DCIKQGWILDGIPETREQALRIQTLGITPRHVIVLSAPDTVLIERNLGKRIDPQTGEIYHTTFDWPPESEIQNRLMVPEDISELETAQKLLEYHRNIVRVIPSYPKILKVISADQPCVDVFYQALTYVQSNHRTNAPFTPRVLLLGPVGSGKSLQAALLAQKYRLVNVCCGQLLKEAVADRTTFGELIQPFFEKEMAVPDSLLMKVLSQRLDQQDCIQKGWVLHGVPRDLDQAHLLNRLGYNPNRVFFLNVPFDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKIP Predict reactive species Full Name: chromosome 9 open reading frame 98 Calculated Molecular Weight: 479 aa, 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC034776 Gene Symbol: C9orf98 Gene ID (NCBI): 158067 RRID: AB_2878796 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MA6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.