Proteintech, 21042-1-AP, CAR/NR1I3 Polyclonal antibody

Size: 20ul / 150ul The CAR/NR1I3 (21042-1-AP) by Proteintech is a Polyclonal antibody targeting CAR/NR1I3 in WB, ELISA applications with reactivity to human samples 21042-1-AP targets CAR/NR1I3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The nuclear hormone receptor superfamily is a large group of related transcription factors which includes members that bind a diverse array of ligands, including steroids, retinoic acid, thyroid hormone, and vitamin D. Nuclear hormone receptors contain a DNA-binding domain (DBD) and a ligand-binding domain [PMID: 10221899]. Nuclear receptor subfamily 1 group I member 3 (NR1I3; Constitutive androstane receptor: CAR), binds and transactivates the retinoic acid response elements that control expression of the retinoic acid receptor beta 2 and alcohol dehydrogenase 3 genes. It is expressed primarily in liver and regulates the expression of genes involved in xenobiotic metabolism as well as hormone, energy, and lipid homeostasis [PMID:22896671]. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15378 Product name: Recombinant human NR1I3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-156 aa of BC069651 Sequence: RRTVSKSIGPTCPFAGSCEVSKTQRRHCPACRLQKCLDAGMRKDMILSAEALALRRAKQAQRRAQQTPVQLSKEQEELIRTLLGAHTRHMGTMFEQFVQFRPPAHLFIHHQPLPTLAPVLPLVTHFADINTFMVLQVIKFTKDLPVFRSL Predict reactive species Full Name: nuclear receptor subfamily 1, group I, member 3 Calculated Molecular Weight: 352 aa, 40 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC069651 Gene Symbol: NR1I3 Gene ID (NCBI): 9970 RRID: AB_10732602 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14994 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.