Product Description
Size: 20ul / 150ul
The CNN2 (21073-1-AP) by Proteintech is a Polyclonal antibody targeting CNN2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
21073-1-AP targets CNN2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells, HepG2 cells
Positive IHC detected in: human heart tissue, human hysteromyoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Immunohistochemistry (IHC): IHC : 1:20-1:200
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
Calponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag15225 Product name: Recombinant human CNN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 224-309 aa of BC141818 Sequence: PGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY Predict reactive species
Full Name: calponin 2
Calculated Molecular Weight: 309 aa, 34 kDa
Observed Molecular Weight: 34-36 kDa
GenBank Accession Number: BC141818
Gene Symbol: CNN2
Gene ID (NCBI): 1265
RRID: AB_10695503
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q99439
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924