Proteintech, 21112-1-AP, DKK1 Polyclonal antibody

Size: 20ul / 150ul The DKK1 (21112-1-AP) by Proteintech is a Polyclonal antibody targeting DKK1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21112-1-AP targets DKK1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, mouse brain tissue, K-562 cells, HeLa cells, mouse heart tissue, rat brain tissue, rat heart tissue Positive IHC detected in: human gliomas tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DKK1, also named a SK and Dickkopf-1, belongs to the dickkopf family. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. SDS-PAGE and Western blot analysis demonstrated that DKK1 is expressed as a 35-kDa doublet protein, which is larger than the deduced molecular mass of 26 kDa. Sometime DKK1 is expressed as a 42- to 50-kDa secreted protein, with little change observed after glycanase treatment. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15110 Product name: Recombinant human DKK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-191 aa of BC001539 Sequence: TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLR Predict reactive species Full Name: dickkopf homolog 1 (Xenopus laevis) Calculated Molecular Weight: 266 aa, 29 kDa Observed Molecular Weight: 30-35 kDa GenBank Accession Number: BC001539 Gene Symbol: DKK1 Gene ID (NCBI): 22943 RRID: AB_10733097 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94907 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.