Proteintech, 21172-1-AP, NSF Polyclonal antibody

Size: 20ul / 150ul The NSF (21172-1-AP) by Proteintech is a Polyclonal antibody targeting NSF in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 21172-1-AP targets NSF in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information The N-ethylmaleimide-sensitive fusion protein (NSF) is a 70-83 kDa cytosol protein that is expressed in all cell types. NSF functions as an ATPase and it is a part of the 20S membrane fusion apparatus with the vesicular SNAP receptor (v-SNARE) synaptobrevin, and the target SNAREs (t-SNARE) syntaxin and SNAP-25. With the hydrolysis of ATP by NSF, the released energy may set-up or drive membrane fusion processes. NSF is required for general membrane transport and trafficking. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15422 Product name: Recombinant human NSF protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 394-744 aa of BC030613 Sequence: EIGLPDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIKASTKVEVDMEKAESLQVTRGDFLASLENDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDAYKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD Predict reactive species Full Name: N-ethylmaleimide-sensitive factor Calculated Molecular Weight: 744 aa, 83 kDa Observed Molecular Weight: 83 kDa GenBank Accession Number: BC030613 Gene Symbol: NSF Gene ID (NCBI): 4905 RRID: AB_2878823 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P46459 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.