Proteintech, 21186-1-AP, KIF5A Polyclonal antibody

Size: 20ul / 150ul The KIF5A (21186-1-AP) by Proteintech is a Polyclonal antibody targeting KIF5A in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 21186-1-AP targets KIF5A in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse brain tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Kinesin superfamily proteins (KIFs) are microtubule-based molecular motors essential for the intracellular transport of various cargos, including organelles, proteins, and RNAs. KIF5A is expressed exclusively in neurons and transports neuronal cargoes into axons and dendrites. KIF5A mutations have been associated with Charcot-Marie-Tooth Type 2, an axonal peripheral neuropathy characterized by progressive loss of peripheral sensation and muscle wasting. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15518 Product name: Recombinant human KIF5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 931-1032 aa of BC146670 Sequence: SPTNPYGTRSPECISYTNSLFQNYQNLYLQATPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQAKLFPLHQETAAS Predict reactive species Full Name: kinesin family member 5A Calculated Molecular Weight: 1032 aa, 117 kDa Observed Molecular Weight: 118-120 kDa GenBank Accession Number: BC146670 Gene Symbol: KIF5A Gene ID (NCBI): 3798 RRID: AB_10733125 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12840 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.