Proteintech, 21192-1-AP, STIM2 Polyclonal antibody

Size: 20ul / 150ul The STIM2 (21192-1-AP) by Proteintech is a Polyclonal antibody targeting STIM2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 21192-1-AP targets STIM2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells Positive IP detected in: HEK-293 cells Positive IHC detected in: mouse spleen tissue, human brain tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information STIM2, also named as KIAA1482, functions as a highly sensitive Ca2+ sensor in the endoplasmic reticulum which activates both store-operated and store-independent Ca2+-influx. Regulates basal cytosolic and endoplasmic reticulum Ca2+ concentrations. Upon mild variations of the endoplasmic reticulum Ca2+ concentration, STIM2 translocates from the endoplasmic reticulum to the plasma membrane where it probably activates the Ca2+ release-activated Ca2+ (CRAC) channels ORAI1, ORAI2 and ORAI3. STIM2 may inhibit STIM1-mediated Ca2+ influx. STIM2 has 2 isoforms 105kd and 115kd with Differential levels of phosphorylation. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15530 Product name: Recombinant human STIM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 525-674 aa of BC146661 Sequence: EKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGGVDDLDEDTPPIVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSHPRHPHHPQHTPHSLPSPDPDILSVSSCPALYRNEEEEEAIYFSAEKQ Predict reactive species Full Name: stromal interaction molecule 2 Calculated Molecular Weight: 754 aa, 85 kDa Observed Molecular Weight: 85-115 kDa GenBank Accession Number: BC146661 Gene Symbol: STIM2 Gene ID (NCBI): 57620 RRID: AB_10734322 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P246 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.