Proteintech, 21362-1-AP, USP17 Polyclonal antibody

Size: 20ul / 150ul The USP17 (21362-1-AP) by Proteintech is a Polyclonal antibody targeting USP17 in WB, ELISA applications with reactivity to human samples 21362-1-AP targets USP17 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information USP17, also known as DUB3, is a deubiquitinating enzyme (DUB) that plays a key role in regulating the balance between ubiquitination and deubiquitination of proteins. This balance is essential for protein degradation, transport, localization, and activity. USP17 is inducibly expressed in response to cytokine, chemokine, and epidermal growth factor (EGF) stimulation, and several studies have shown that it is required for cell proliferation and migration. Aberrantly expressed USP17 has been associated with inflammation, cell motility, development of T helper 17 (Th17) cells and carcinogenesis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15824 Product name: Recombinant human USP17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-317 aa of BC100991 Sequence: DIALDIQAAQSVQQALEQLVKPEELNGENAYHCGVCLQRAPASKTLTLHTSAKVLILVLKRFSDVTGNKIAKNVQYPECLDMQPYMSQQNTGPLVY Predict reactive species Full Name: ubiquitin specific peptidase 17 Calculated Molecular Weight: 530 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC100991 Gene Symbol: USP17 Gene ID (NCBI): 391627 RRID: AB_3669365 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.