Proteintech, 21371-1-AP, PKIG Polyclonal antibody

Size: 20ul / 150ul The PKIG (21371-1-AP) by Proteintech is a Polyclonal antibody targeting PKIG in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 21371-1-AP targets PKIG in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15878 Product name: Recombinant human PKIG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC104257 Sequence: MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPDKEAGNQPQSSDGTTSS Predict reactive species Full Name: protein kinase (cAMP-dependent, catalytic) inhibitor gamma Calculated Molecular Weight: 76 aa, 8 kDa Observed Molecular Weight: 5-8 kDa GenBank Accession Number: BC104257 Gene Symbol: PKIG Gene ID (NCBI): 11142 RRID: AB_10858922 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2B9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.