Iright
BRAND / VENDOR: Proteintech

Proteintech, 21394-1-AP, RLBP1L2 Polyclonal antibody

CATALOG NUMBER: 21394-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RLBP1L2 (21394-1-AP) by Proteintech is a Polyclonal antibody targeting RLBP1L2 in WB, ELISA applications with reactivity to human, mouse, rat samples 21394-1-AP targets RLBP1L2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, Jurkat cells, L02 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16061 Product name: Recombinant human RLBP1L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 265-327 aa of BC101376 Sequence: LLDHEYDDDSEYNVDSYSMPVKEVEKELSPKSMKRSQSVVDPTVLKRMDKNEEENMQPLLSLD Predict reactive species Full Name: retinaldehyde binding protein 1-like 2 Calculated Molecular Weight: 327 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC101376 Gene Symbol: RLBP1L2 Gene ID (NCBI): 134829 RRID: AB_10732818 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5SYC1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924