Proteintech, 21402-1-AP, UHRF1 Polyclonal antibody

Size: 20ul / 150ul The UHRF1 (21402-1-AP) by Proteintech is a Polyclonal antibody targeting UHRF1 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 21402-1-AP targets UHRF1 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HuH-7 cells, HEK-293T cells, HeLa cells, MCF-7 cells Positive IP detected in: HeLa cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information UHRF1, also named as ICBP90, NP95 and RNF106, is a putative E3 ubiquitin-protein ligase. It may participate in methylation-dependent transcriptional regulation. UHRF1 binds to inverted 5'-CCAAT-3' box 2 in the TOP2A promoter, and activates TOP2A expression. It is important for G1/S transition and may be involved in DNA repair and chromosomal stability. UHRF1's ability to repress its direct target gene expression is dependent on PHD(UHRF1) binding to unmodified H3R2. In addition, UHRF1 is a novel metabolic guardian restricting AMPK activity(PMID: 34907338). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16111 Product name: Recombinant human UHRF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 88-392 aa of BC113875 Sequence: QSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECRNDASEVVLAGERLRE Predict reactive species Full Name: ubiquitin-like with PHD and ring finger domains 1 Calculated Molecular Weight: 806 aa, 91 kDa Observed Molecular Weight: 91-100 kDa GenBank Accession Number: BC113875 Gene Symbol: UHRF1 Gene ID (NCBI): 29128 RRID: AB_10860902 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96T88 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.