Proteintech, 21418-1-AP, ASTL Polyclonal antibody

Size: 20ul / 150ul The ASTL (21418-1-AP) by Proteintech is a Polyclonal antibody targeting ASTL in WB, ELISA applications with reactivity to human samples 21418-1-AP targets ASTL in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15997 Product name: Recombinant human ASTL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-431 aa of BC107127 Sequence: SPFRLLSATSNKWPMGGSGVVEVPFLLSSKYDEPSRQVILEALAEFERSTCIRFVTYQDQRDFISIIPMYGCFSSVGRSGGMQVVSLAPTCLQKGRGIVLHELMHVLGFWHEHTRADRDRYIRVNWNEILPGFEINFIKSRSSNMLTPYDYSSVMHYGRLAFSRRGLPTITPLWAPSVHIGQRWNLSASDITRVLQLYGCSPSGPRPRGRGSHAHSTGRSPAPASLSLQRLLEALSAESRSPDPSGSSAGGQPVPAGPGESPHGWESPALKKLSAEASARQPQTLASSPRSRPGAGAPGVAQEQSWLAGVSTKPTVPSSEAGIQPVPVQGSPALPGGCVPRNHFKGMSED Predict reactive species Full Name: astacin-like metallo-endopeptidase (M12 family) Calculated Molecular Weight: 431 aa, 46 kDa Observed Molecular Weight: 43 kDa GenBank Accession Number: BC107127 Gene Symbol: ASTL Gene ID (NCBI): 431705 RRID: AB_2878855 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6HA08 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.