Proteintech, 21520-1-AP, TNFRSF13B/CD267 Polyclonal antibody

Size: 20ul / 150ul The TNFRSF13B/CD267 (21520-1-AP) by Proteintech is a Polyclonal antibody targeting TNFRSF13B/CD267 in WB, ELISA applications with reactivity to human samples 21520-1-AP targets TNFRSF13B/CD267 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: IM-9 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Tumor necrosis factor receptor superfamily member 13B (TNFRSF13B), also known as CD267 or TACI, is a transmembrane protein of the TNF receptor superfamily found predominantly on B cells (PMID: 10920230). TACI is also expressed on activated T cells, myeloma cells, and expressed by monocytes intracellularly at a low level (PMID: 11429548; 16825497). TNFRSF13B is a receptor for TNFSF13/APRIL/CD256 and TNFSF13B/BAFF/CD257 and mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-κB and AP-1 (PMID: 10956646; 10973284; 9311921). It is involved in the stimulation of B- and T-cell function and the regulation of humoral immunity. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16097 Product name: Recombinant human TNFRSF13B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 133-247 aa of BC109392 Sequence: LVAVACFLKKRGDPCSCQPRSRPRQSPAKSSQDHAMEAGSPVSTSPEPVETCSFCFPECRAPTQESAVTPGTPDPTCAGRWGCHTRTTVLQPCPHIPDSGLGIVCVPAQEGGPGA Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 13B Calculated Molecular Weight: 293 aa, 32 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC109392 Gene Symbol: TNFRSF13B/CD267 Gene ID (NCBI): 23495 RRID: AB_10888631 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14836 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.