Proteintech, 21526-1-AP, Glypican 6 Polyclonal antibody

Size: 20ul / 150ul The Glypican 6 (21526-1-AP) by Proteintech is a Polyclonal antibody targeting Glypican 6 in WB, ELISA applications with reactivity to human samples 21526-1-AP targets Glypican 6 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, L02 cells, MG-63 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Glypican-6 (GPC6) is a glycosylphosphatidylinositol-anchored heparan-sulfate proteoglycan that regulates cell-surface signaling cues during development and disease. GPC6 binds Hedgehog ligands and facilitates their interaction with the receptor Patched, thereby amplifying Hh signaling required for long-bone and gastric/intestinal elongation. (PMID: 35235423) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16135 Product name: Recombinant human GPC6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 213-278 aa of BC106947 Sequence: RAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCL Predict reactive species Full Name: glypican 6 Calculated Molecular Weight: 555 aa, 63 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC106947 Gene Symbol: GPC6 Gene ID (NCBI): 10082 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y625 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.