Iright
BRAND / VENDOR: Proteintech

Proteintech, 21568-1-AP, SLC25A25 Polyclonal antibody

CATALOG NUMBER: 21568-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC25A25 (21568-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A25 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 21568-1-AP targets SLC25A25 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, RAW264.7 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16086 Product name: Recombinant human SLC25A25 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-53 aa of BC103933 Sequence: MLCLCLYVPVIGEAQTEFQYFESKGLPAELKSIFKLSVFIPSQEFSTYRQWKQ Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25 Calculated Molecular Weight: 469 aa, 53 kDa Observed Molecular Weight: 50 kDa, 100 kDa GenBank Accession Number: BC103933 Gene Symbol: SLC25A25 Gene ID (NCBI): 114789 RRID: AB_10858638 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6KCM7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924